About Recombinant Human Syndecan-2/SDC2/CD362 (C-6His)

The following list shows the most important features of our product:

Size

10 ug

Catalog no

C635-10

Product photo

product photo

Ordering

A simple ordering process. Just click the button below and go to our store page.

Details

Below is a list of details about the product.

Detail Description
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Description Recombinant Human Syndecan-2 is produced by our Mammalian expression system and the target gene encoding Glu19-Glu144 is expressed with a 6His tag at the C-terminus.
Peptide sequence ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVDHHHHHH
Package form Lyophilized from a 0.2 µm filtered solution of 20mM Tris-Citrate, 150mM NaCl, pH 7.0.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Source Recombinants or rec. proteins
Shipping condition Ambient/Room Temperature
Group recombinants
Origin Human cells
Estimated molecular weight 14,98 kDa
UniProt number P34741
Species reactivity Human