The best Syndecan - 4 (Human) ELISA kit, Syndecan antibody, Syndecan 1 Antibody ALEXA FLUOR 555 products, quick delivery, high quality.
The following list shows the most important features of our product:
10 ug
C776-10
A simple ordering process. Just click the button below and go to our store page.
Below is a list of details about the product.
Detail | Description |
---|---|
Test | Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain. |
Peptide sequence | MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEVLEHHHHHH |
Reconstitution conditions | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage conditions | Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months. |
Description | Recombinant Mouse Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val299 is expressed with a 6His tag at the C-terminus. |
Package form | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Endotoxin level | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Protein purity | Greater than 95% as determined by reducing SDS-PAGE. |
Source | Recombinants or rec. proteins |
Shipping condition | Ambient/Room Temperature |
Origin | Escherichia coli |
Latin name | Mus musculus |
Group | recombinants |
Estimated molecular weight | 33,4 kDa |
UniProt number | O08992 |
Species reactivity | Mouse |