The best Syndecan - 4 (Human) ELISA kit, Syndecan antibody, Syndecan 1 Antibody ALEXA FLUOR 555 products, quick delivery, high quality.
The following list shows the most important features of our product:
500 ug
C635-500
A simple ordering process. Just click the button below and go to our store page.
Below is a list of details about the product.
| Detail | Description |
|---|---|
| Properties | Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples. |
| Reconstitution conditions | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage conditions | Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months. |
| Description | Recombinant Human Syndecan-2 is produced by our Mammalian expression system and the target gene encoding Glu19-Glu144 is expressed with a 6His tag at the C-terminus. |
| Peptide sequence | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVDHHHHHH |
| Package form | Lyophilized from a 0.2 µm filtered solution of 20mM Tris-Citrate, 150mM NaCl, pH 7.0. |
| Endotoxin level | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Protein purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Source | Recombinants or rec. proteins |
| Shipping condition | Ambient/Room Temperature |
| Group | recombinants |
| Origin | Human cells |
| Estimated molecular weight | 14,98 kDa |
| UniProt number | P34741 |
| Species reactivity | Human |