About Recombinant Mouse Syndecan-4/SDC4 (C-6His)

The following list shows the most important features of our product:

Size

50 ug

Catalog no

CJ11-50

Product photo

product photo

Ordering

A simple ordering process. Just click the button below and go to our store page.

Details

Below is a list of details about the product.

Detail Description
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Description Recombinant Mouse Syndecan-4 is produced by our Mammalian expression system and the target gene encoding Glu24-Glu145 is expressed with a 6His tag at the C-terminus.
Peptide sequence ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVDHHHHHH
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Reconstitution conditions See included datasheet or contact us for more information.
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Source Recombinants or rec. proteins
Shipping condition Ambient/Room Temperature
Latin name Mus musculus
Group recombinants
Origin Human cells
Estimated molecular weight 14,4 kDa
UniProt number O35988
Species reactivity Mouse