The best quality, top Anti - SDCBP Antibody, Anti - Syndecan 4 (SDC4) Antibody, Recombinant Human Syndecan - 4 products prices, the best delivery.
The following list shows the most important features of our product:
50 ug
CJ11-50
A simple ordering process. Just click the button below and go to our store page.
Below is a list of details about the product.
Detail | Description |
---|---|
Test | Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain. |
Storage conditions | Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months. |
Description | Recombinant Mouse Syndecan-4 is produced by our Mammalian expression system and the target gene encoding Glu24-Glu145 is expressed with a 6His tag at the C-terminus. |
Peptide sequence | ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVDHHHHHH |
Package form | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Endotoxin level | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Reconstitution conditions | See included datasheet or contact us for more information. |
Protein purity | Greater than 95% as determined by reducing SDS-PAGE. |
Source | Recombinants or rec. proteins |
Shipping condition | Ambient/Room Temperature |
Latin name | Mus musculus |
Group | recombinants |
Origin | Human cells |
Estimated molecular weight | 14,4 kDa |
UniProt number | O35988 |
Species reactivity | Mouse |