About Sdc3 Blocking Peptide

The following list shows the most important features of our product:

Size

100 ug

Catalog no

33R-3406

Product photo

product photo

Ordering

A simple ordering process. Just click the button below and go to our store page.

Details

Below is a list of details about the product.

Detail Description
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Test You can block the antibody by the specific target amino acid sequence of peptide.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Tag/Conjugate GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL
Research Area Signal Transduction
Product Subtype Blocking Peptides
Properties blocking peptide
Type1 Synthetic
Product Type Proteins
Shipping Info Blue Ice
Applications WB, IHC