Product photo
The best Syndecan - 4 (Human) ELISA kit, Syndecan antibody, Syndecan 1 Antibody ALEXA FLUOR 555 products, quick delivery, high quality.
The following list shows the most important features of our product:
100 ug
33R-9561
A simple ordering process. Just click the button below and go to our store page.
Below is a list of details about the product.
| Detail | Description |
|---|---|
| Description | Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
| Test | You can block the antibody by the specific target amino acid sequence of peptide. |
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
| Tag/Conjugate | VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV |
| Research Area | Cytokines & Growth Factors |
| Product Subtype | Blocking Peptides |
| Properties | blocking peptide |
| Type1 | Synthetic |
| Product Type | Proteins |
| Shipping Info | Blue Ice |
| Applications | WB, IHC |